Formulation and evaluation of tenoxicam ethosomes as a novel drug carrier

RamyaTeja Medarametla; Venkata Gopaiah K; N. Suresh Kumar J; Glory Ch; Neelima L; Samuel morise J; Venkateswarlu Naik B; Ayyappa Reddy B; Sudheer B

doi:10.37022/jpmhs.v6i4.96

Authors

RamyaTeja Medarametla Associate professor, Narasaraopet Institute of Pharmaceutical Sciences, Narasaraopet, Palnadu, A.P
K. Venkata Gopaiah Associate professor, Narasaraopet Institute of Pharmaceutical Sciences, Narasaraopet, Palnadu, A.P
J. N. Suresh Kumar Narasaraopeta Institute of Pharmaceutical Sciences, Narasaraopet, A.P.
Ch. Glory Narasaraopet Institute of Pharmaceutical Sciences, Narasaraopet, Palnadu, A.P
L. Neelima Narasaraopet Institute of Pharmaceutical Sciences, Narasaraopet, Palnadu, A.P
J. Samuel morise Narasaraopet Institute of Pharmaceutical Sciences, Narasaraopet, Palnadu, A.P
Venkateswarlu Naik Narasaraopet Institute of Pharmaceutical Sciences, Narasaraopet, Palnadu, A.P
B. Ayyappa Reddy Narasaraopet Institute of Pharmaceutical Sciences, Narasaraopet, Palnadu, A.P
B. Sudheer A.S.N. Pharmacy College, Tenali-A.P.

DOI:

https://doi.org/10.37022/jpmhs.v6i4.96

Keywords:

tenoxicam, penetrating liposome, ethosome system.

Abstract

The aim of this study is to create an alcohol-based tenoxicam gel for transversal delivery. Tenoxicam is a non-steroidal anti-inflammatory BCSII drug with low solubility and high permeability. It is prepared thermally using alcohol, phospholipids and ethanol. Alcosomes are phospholipid- based elastic nanoparticles containing high levels of ethanol (20-45%), which is known to be highly accessible. Ethanol systems are more effective at delivering the speed and depth of medication to the skin than liposomes or hydroalcoholic solutions. FTIR studies show that there is no interaction between the drug and the additive. Formulation F8 (ethanol 30% v/v and lecithin 1% w/w) was selected as the best formulation due to its small size, encapsulation efficiency, low turbidity, and highest in vitro release. A 3-month stability study was carried out on the F8 formulation using Carbopol 934 base (1,1.5, 2% w/w) at two different temperatures, 25°±2°C and 4°±2°C. The maximum in vitro release rate of carbomer concentration in rat skin at 1.5% w/w is 95.06 ± 0.15%, and the in vitro release rate is 86.65 ± 0.38%.

Downloads

Download data is not yet available.

Author Biography

RamyaTeja Medarametla, Associate professor, Narasaraopet Institute of Pharmaceutical Sciences, Narasaraopet, Palnadu, A.P

Associate professor, Narasaraopet Institute of Pharmaceutical Sciences, Narasaraopet, Palnadu, A.P

References

R.Lamsal,A.GeethalakshmiandS.Gubbala,“Formulationandevaluationofgliclazideethosomes

asanovel drug carrier. Published01 may-2015,vol.6(5)pagenumber:2072-2080.

AnishP.Thomas,RaghvendraDubey,PrabhatJain“Formulationandevaluationofethosomalgel

oftazarotenefortopical delivery.AsianjournalofpharmaceuticsJan-mar 2019.13(1)|37.

Touitou E, Dayan N, Bergelson L, Godin B, Eliaz M, Ethosomes novel vesicular carriers forenhanced delivery: characterization and skin penetration properties, J control release 2000; 65:403-418.

SheoDattaMaurya,SunilKumarPrajapati,AnishKumarGuptaGyanendraKumarSaxenaandRamChandDhakar“FormulationDevelopmentandEvaluationofethosomeofstavudine.Indianjournalof pharmaceutical education and research, received on 15thDec – 2008 Accepted on 19th July 2009,pagenumbers:102-108.

Touitou E, Godin B and Weiss c. Enhanced delivery of drug into and across the skin by ethosomalcarrier.Drug delivery research.2000; 50:406-415.

PaolinoD, Touitou E, Rubinstein E, AthamnaA, Athamna M. A new approach for treatment ofdeep skin infections by an ethosomal antibiotic preparation: an in-vivo study. J Antimicrobialchemotherapy.2005; 55(6):989-994.

RizwanM,AqilM,TalegoankarS,AzeemA,SultanaY,AilA.Enhancedtransdermaldrugdeliverytechniques:Anextensivereviewon patents.Recent patdrug deliveryformula2009;3:105-24.

Shingade G. Review on: Recent trend on trans dermal drug delivery system. J Drug Delivery 2012;2:66-75.

Zhaoa YZ, Zhanga Y, Xiaoa J, Zhaob YP, Tianc JL, Xud YY, et al. Selection of highly efficienttransdermallipid vesicle forcurcumin skindelivery. IntJPharm2013;454:1-15.

KumarP,SankarC,MishraB.Deliveryofmacromoleculesthroughskin.Indiapharma2004:5:7-17.

Touitou E, Godin B and Weiss C: Enhanced delivery of drug into and across the skin by theethosomalcarrier. Drugdevelops.Res.2000;50:406-15.

HadgraftJ.Passiveenhancementstrategiesintopicalandtransdermaldrugdelivery. IntJPharm. 1999;184:1–6.

Lopez-Pinto JM, Gonzalez-Rodriguez ML, Rabasco AM. Effect of cholesterol and ethanol ondermaldeliveryfrom DPPC liposomes.IntJPharm.2005; 298:1–12.

PaolinoD,LucaniaG,MardenteD,AlhaiqueF,FrestaM.Ethosomesforskindeliveryofammonium glycyrrhizinate: In vitro percutaneous permeation through human skin and in vivo anti-inflammatoryactivity on human volunteers.JControlRelease. 2005; 106:99–110.

Quality by design driven development of resveratrol loaded ethosomal hydrogel for improveddermatologicalbenefitsviaenhancedskinpermeationandretention.InternationalJournalofPharmaceutics,Volume567, 2019, Article 118448

BragagniM,MenniniN,MaestrelliF,CirriM,MuraP.Comparativestudyofliposomes,transfersomes and ethosomes as carriers for improving topical delivery of celecoxib. J Drug Deliv.2012; 19:354–61.

BabuR,KanikkannanN,KikwaiL,OrtegaC,AndegaS,BallK,YimS,SinghM.Theinfluenceofvarious methods of cold storage of skin on the permeation of melatonin and nimesulide. J ControlRelease.2013; 86:49–57.

Panigrahi L, Ghosal SK, Pattnaik S, Maharana L, Barik BB. Effect of permeation enhancers on therelease and permeation kinetics of lincomycin hydrochloride gel formulations through mouse skin.IndianJPharm Sci.2006; 68:205–11.

LiuaY,PanaJ,FengaS.Nanoparticlesoflipidmonolayershellandbiodegradablepolymercoreforcontrolled release of paclitaxel: effects of surfactants on particles size, characteristics and in vitroperformance.Int JPharm.2010; 16:243–50.

Dave V, Kumar D, Lewis S, Paliwal S. Ethosome for enhanced transdermal drug delivery ofAceclofenac.Int JDrugDeliv.2010; 2:81–92.

Abdul A, Mohammad R, Al MAM, Al JFI, Alam MA. Enhanced anti-inflammatory activity ofcarbopolloaded meloxicam nanoethosomalgels.Int JBiolMacromol., 2014;67:99-104.

AinbinderD,TouitouE.Testosteroneethosomesforenhancedtransdermaldelivery.DrugDelivery.2005;12(5):297-303.

Dinesh M, Pradyumna KM, Sunil D, Vaibhav D, Manoj N, Narendra KJ. Comparative evaluationof hepatitis B surface antigen-loaded elastic liposomes and ethosomes for human dendritic celluptakeand immune response. Nanomedicine. 2010;6(1):110-118.

LiNS,YongTZ,QinW,LingX,NianPF.Enhancedinvitroandinvivoskindepositionofapigenindeliveredusing ethosomes.Int JPharm., 2014;460(1-2):280-288.

Limsuwan T, Amnuaikit T. Development of ethosomes containing Mycophenolic acid. ProcediaChem.2012; 4:328-335.

MahmoudMI,SalmaAH,MahmoudMM.Organogels,hydrogelsandbigelsastransdermaldeliverysystemsfordiltiazem hydrochloride. AsianJPharm Sci,. 2013;8(1):48-57.

PoonamV,KamlaP.Nanosizedethanolicvesiclesloadedwitheconazolenitrateforthetreatmentofdeepfungal infectionsthrough topicalgel formulation. Nanomedicine. 2012;8(4):489-496.

Ravindra B, Ajay V, Sanjay J. Development and characterisation of ethosomes bearing LosartanPotassiumfortransdermal drug delivery. Int JPharm PharmSci,.2013;5(1);35-40.

Sheo DM. Enhanced transdermal permeation of Indinavirsulphate through Stratum Cornea via.Novelpermeation enhancers:Ethosomes.Der PharmLett,. 2010;2(5):208-220.

SubheetJ,TiwaryAK,SapraB,JainNK.FormulationandEvaluationofethosomesfortransdermaldeliveryofLamivudine.APPS PharmSciTech. 2007;8(4):E111-E119.

SujithaB,KrishnamoorthyB,MuthukumaranM.FormulationandevaluationofPiroxicamLoadedethosomalgel fortransdermal delivery.Int JPharmGen Res,.2014;2(1):34-45.

Vaibhav D, Dinesh M, Jain NK. Melatonin loaded ethanolic liposomes: Physicochemical andenhancedtransdermal delivery. EurJPharm Biopharm ,.2007;67(2):398-405.